PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun002683
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 291aa    MW: 32065.1 Da    PI: 8.2952
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-33585PU_refplantGDBView CDS
gnl|UG|Vun#S45882803PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.9e-19145199256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++tkeq   Lee F+++++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  Vun002683 145 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALAKQLGLRPRQVEVWFQNRRARTK 199
                788899***********************************************98 PP

2HD-ZIP_I/II126.61.1e-40145234191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+keq++lLEesF+++++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
    Vun002683 145 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALAKQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 234
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.52E-19135202IPR009057Homeodomain-like
PROSITE profilePS5007117.637141201IPR001356Homeobox domain
SMARTSM003891.3E-16143205IPR001356Homeobox domain
PfamPF000468.0E-17145199IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-18145199IPR009057Homeodomain-like
CDDcd000866.34E-17145202No hitNo description
PRINTSPR000319.5E-6172181IPR000047Helix-turn-helix motif
PROSITE patternPS000270176199IPR017970Homeobox, conserved site
PRINTSPR000319.5E-6181197IPR000047Helix-turn-helix motif
PfamPF021835.6E-10201235IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.8E-25201244IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGLHQDPTDQ GLQLILGLAL TTSTPDNTVT PSPPSISNTL HHLTTTHRPN PYSSKSTFIS  60
TNNSQAEPSL TLALSRHTYP DQLLKLSSED PLEQTSPHSA ISSFSGGSGR VKRERDLSCE  120
EADATETERV SSRASDEEED GTTARKKLRL TKEQSALLEE SFKQHSTLNP KQKQALAKQL  180
GLRPRQVEVW FQNRRARTKL KQTEVDCEFL KKCCETLTDE NRRLQKELQE LKALKLAQPL  240
YMPMSAATLT MCPSCERLGG GVGGGASTKS PFSMAPKPHF FNPFANPSAA C
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193201RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155789.11e-170hypothetical protein PHAVU_003G232000g
SwissprotP466044e-91HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLV7CEJ41e-170V7CEJ4_PHAVU; Uncharacterized protein
STRINGGLYMA11G04840.11e-132(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-81HD-ZIP family protein